Lineage for d2brrh1 (2brr H:115-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655393Domain d2brrh1: 2brr H:115-214 [129010]
    Other proteins in same PDB: d2brrl1, d2brrl2, d2brrx1, d2brrx2
    automatically matched to d1igtb2
    complexed with acy, nh2, so4

Details for d2brrh1

PDB Entry: 2brr (more details), 1.95 Å

PDB Description: Complex of the neisserial PorA P1.4 epitope peptide and two Fab- fragments (antibody MN20B9.34)
PDB Compounds: (H:) mn20b9.34 anti-p1.4 antibody, fab heavy chain

SCOP Domain Sequences for d2brrh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brrh1 b.1.1.2 (H:115-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg

SCOP Domain Coordinates for d2brrh1:

Click to download the PDB-style file with coordinates for d2brrh1.
(The format of our PDB-style files is described here.)

Timeline for d2brrh1: