Lineage for d2br4f_ (2br4 F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612760Family c.66.1.50: CmcI-like [142632] (1 protein)
    Pfam PF04989; may have evolved different enzymatic activity
  6. 1612761Protein Cephalosporin hydroxylase CmcI [142633] (1 species)
  7. 1612762Species Streptomyces clavuligerus [TaxId:1901] [142634] (5 PDB entries)
    Uniprot O85726 2-233
  8. 1612780Domain d2br4f_: 2br4 F: [128987]
    automated match to d2br3a1
    complexed with mg, p4c, peg, sam

Details for d2br4f_

PDB Entry: 2br4 (more details), 2.59 Å

PDB Description: cmci-d160 mg-sam
PDB Compounds: (F:) cephalosporin hydroxylase cmci

SCOPe Domain Sequences for d2br4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br4f_ c.66.1.50 (F:) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]}
ndysrqnfldlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrgl
rmlkdpdtqavyhdmlwelrprtivelgvynggslawfrdltkimgidcqvigidrdlsr
cqipasdmenitlhqgdcsdlttfehlremahplifiddahantfnimkwavdhlleegd
yfiiedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrv

SCOPe Domain Coordinates for d2br4f_:

Click to download the PDB-style file with coordinates for d2br4f_.
(The format of our PDB-style files is described here.)

Timeline for d2br4f_: