Class a: All alpha proteins [46456] (284 folds) |
Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) |
Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries) |
Domain d2bq1f1: 2bq1 F:13-174 [128955] Other proteins in same PDB: d2bq1e2, d2bq1f2, d2bq1i1, d2bq1j1 automatically matched to d1pema1 complexed with dgt, fe, mg |
PDB Entry: 2bq1 (more details), 3.99 Å
SCOP Domain Sequences for d2bq1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bq1f1 a.98.1.1 (F:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge
Timeline for d2bq1f1:
View in 3D Domains from other chains: (mouse over for more information) d2bq1e1, d2bq1e2, d2bq1i1, d2bq1j1 |