Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
Domain d2bp7f2: 2bp7 F:206-339 [128934] Other proteins in same PDB: d2bp7a_, d2bp7b1, d2bp7c_, d2bp7d1, d2bp7e_, d2bp7f1, d2bp7g_, d2bp7h1 automated match to d1qs0b2 |
PDB Entry: 2bp7 (more details), 2.9 Å
SCOPe Domain Sequences for d2bp7f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bp7f2 c.48.1.2 (F:206-339) automated matches {Pseudomonas putida [TaxId: 303]} yytvpldkaaitrpgndvsvltygttvyvaqvaaeesgvdaevidlrslwpldldtives vkktgrcvvvheatrtcgfgaelvslvqehcfhhleapiervtgwdtpyphaqewayfpg psrvgaalkkvmev
Timeline for d2bp7f2: