Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186988] (3 PDB entries) |
Domain d2bp3b_: 2bp3 B: [128920] Other proteins in same PDB: d2bp3a1 automated match to d1v05a_ complexed with gol |
PDB Entry: 2bp3 (more details), 2.32 Å
SCOPe Domain Sequences for d2bp3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bp3b_ b.1.18.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvsy lpvlpgdysilvkyneqhvpgspftarvtgd
Timeline for d2bp3b_: