SCOPe 2.02: Domain d2bp3b_: 2bp3 B:

Lineage for d2bp3b_ (2bp3 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (3 PDB entries)

8. Domain d2bp3b_: 2bp3 B: [128920]
   Other proteins in same PDB: d2bp3a1
   automated match to d1v05a_
   complexed with gol

Details for d2bp3b_

PDB Entry: 2bp3, 2.32 Å

PDB Description: crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex

PDB Compounds: (B:) Filamin A

SCOPe Domain Sequences for d2bp3b_:

Sequence; same for both SEQRES and ATOM records:

>d2bp3b_ b.1.18.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvsy
lpvlpgdysilvkyneqhvpgspftarvtgd

Timeline for d2bp3b_:

• d2bp3b_ first appeared in SCOP 1.73, called d2bp3b1
  
• d2bp3b_ appears in SCOPe 2.01
  
• d2bp3b_ appears in SCOPe 2.03
  
• d2bp3b_ appears in the current release, SCOPe 2.08