Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
Protein Filamin a [141023] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141024] (4 PDB entries) Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328 |
Domain d2bp3a1: 2bp3 A:1863-1954 [128919] Other proteins in same PDB: d2bp3b_ 17th repeat complexed with gol |
PDB Entry: 2bp3 (more details), 2.32 Å
SCOPe Domain Sequences for d2bp3a1:
Sequence, based on SEQRES records: (download)
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} vncghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsv sylpvlpgdysilvkyneqhvpgspftarvtg
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} vnchvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvs ylpvlpgdysilvkyneqhvpgspftarvtg
Timeline for d2bp3a1: