Lineage for d2bp3a1 (2bp3 A:1863-1954)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524391Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 1524405Protein Filamin a [141023] (1 species)
  7. 1524406Species Human (Homo sapiens) [TaxId:9606] [141024] (4 PDB entries)
    Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328
  8. 1524410Domain d2bp3a1: 2bp3 A:1863-1954 [128919]
    Other proteins in same PDB: d2bp3b_
    17th repeat
    complexed with gol

Details for d2bp3a1

PDB Entry: 2bp3 (more details), 2.32 Å

PDB Description: crystal structure of filamin a domain 17 and gpib alpha cytoplasmic domain complex
PDB Compounds: (A:) Filamin A

SCOPe Domain Sequences for d2bp3a1:

Sequence, based on SEQRES records: (download)

>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
vncghvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsv
sylpvlpgdysilvkyneqhvpgspftarvtg

Sequence, based on observed residues (ATOM records): (download)

>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]}
vnchvtaygpglthgvvnkpatftvntkdagegglslaiegpskaeisctdnqdgtcsvs
ylpvlpgdysilvkyneqhvpgspftarvtg

SCOPe Domain Coordinates for d2bp3a1:

Click to download the PDB-style file with coordinates for d2bp3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bp3a1: