Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (50 PDB entries) |
Domain d2bozl1: 2boz L:1-281 [128918] automatically matched to d1aigl_ complexed with bcl, bh1, d10, fe, lda, po4, spn, u10; mutant |
PDB Entry: 2boz (more details), 2.4 Å
SCOP Domain Sequences for d2bozl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bozl1 f.26.1.1 (L:1-281) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d2bozl1: