Lineage for d2bocc_ (2boc C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252772Protein automated matches [190184] (3 species)
    not a true protein
  7. 2252781Species Streptomyces lividans [TaxId:1916] [186922] (14 PDB entries)
  8. 2252794Domain d2bocc_: 2boc C: [128908]
    Other proteins in same PDB: d2bocb1, d2bocb2
    automated match to d1r3jc_
    complexed with co, t1a, tl

Details for d2bocc_

PDB Entry: 2boc (more details), 3.01 Å

PDB Description: potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
PDB Compounds: (C:) potassium channel kcsa

SCOPe Domain Sequences for d2bocc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bocc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2bocc_:

Click to download the PDB-style file with coordinates for d2bocc_.
(The format of our PDB-style files is described here.)

Timeline for d2bocc_: