Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein automated matches [190184] (3 species) not a true protein |
Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries) |
Domain d2bocc_: 2boc C: [128908] Other proteins in same PDB: d2bocb1, d2bocb2 automated match to d1r3jc_ complexed with co, t1a, tl |
PDB Entry: 2boc (more details), 3.01 Å
SCOPe Domain Sequences for d2bocc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bocc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2bocc_: