![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (2 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [161074] (17 PDB entries) |
![]() | Domain d2bobc_: 2bob C: [128907] Other proteins in same PDB: d2boba1, d2boba2, d2bobb1, d2bobb2 automated match to d1r3jc_ complexed with co, tba, tl |
PDB Entry: 2bob (more details), 2.76 Å
SCOPe Domain Sequences for d2bobc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bobc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2bobc_:
![]() Domains from other chains: (mouse over for more information) d2boba1, d2boba2, d2bobb1, d2bobb2 |