Class a: All alpha proteins [46456] (258 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (8 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.4: Omega transcriptional repressor [100971] (1 protein) plasmid-encoded, similar to the phage repressor family |
Protein Omega transcriptional repressor [69031] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [69032] (4 PDB entries) |
Domain d2bnwc1: 2bnw C:23-71 [128859] automatically matched to d1irqb_ |
PDB Entry: 2bnw (more details), 2.45 Å
SCOP Domain Sequences for d2bnwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnwc1 a.43.1.4 (C:23-71) Omega transcriptional repressor {Streptococcus pyogenes [TaxId: 1314]} dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
Timeline for d2bnwc1: