Lineage for d2bnpa1 (2bnp A:1-281)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746204Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 746205Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 746206Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 746207Protein L (light) subunit [81477] (3 species)
  7. 746208Species Rhodobacter sphaeroides [TaxId:1063] [81475] (50 PDB entries)
  8. 746242Domain d2bnpa1: 2bnp A:1-281 [128847]
    Other proteins in same PDB: d2bnpb1
    automatically matched to d1aigl_
    complexed with bcl, bh1, cl, fe2, mst, po4, u10

Details for d2bnpa1

PDB Entry: 2bnp (more details), 2.7 Å

PDB Description: lipidic cubic phase grown reaction centre from rhodobacter sphaeroides, ground state
PDB Compounds: (A:) reaction centre protein l chain

SCOP Domain Sequences for d2bnpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnpa1 f.26.1.1 (A:1-281) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d2bnpa1:

Click to download the PDB-style file with coordinates for d2bnpa1.
(The format of our PDB-style files is described here.)

Timeline for d2bnpa1: