Lineage for d2bmrb1 (2bmr B:1-194)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855839Family d.17.4.4: Ring hydroxylating beta subunit [54438] (6 proteins)
    Pfam PF00866
  6. 855878Protein Nitrobenzene dioxygenase beta subunit, NBDO-beta [142999] (1 species)
  7. 855879Species Comamonas sp. JS765 [TaxId:58226] [143000] (3 PDB entries)
    Uniprot Q8RTL3 1-194
  8. 855881Domain d2bmrb1: 2bmr B:1-194 [128812]
    Other proteins in same PDB: d2bmra1, d2bmra2
    automatically matched to 2BMO B:1-194
    complexed with 3nt, edo, eoh, fe, fes, ni

Details for d2bmrb1

PDB Entry: 2bmr (more details), 1.5 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene
PDB Compounds: (B:) oxygenase-beta nbdo

SCOP Domain Sequences for d2bmrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmrb1 d.17.4.4 (B:1-194) Nitrobenzene dioxygenase beta subunit, NBDO-beta {Comamonas sp. JS765 [TaxId: 58226]}
mmintqedklvsahdaeefhrffvghdsdlqqevttlltreahlldiqaykawlehfvap
eikyqvisrelrstserryqlndavnlynenyqqlkvrvehqmdpqnwannpkirftrfv
tnvtaakdksapeilhvrsnlilhrarrenqvdvfyatredkwkriegggiklverfvdy
peripqthnllvfl

SCOP Domain Coordinates for d2bmrb1:

Click to download the PDB-style file with coordinates for d2bmrb1.
(The format of our PDB-style files is described here.)

Timeline for d2bmrb1: