Lineage for d2bmra1 (2bmr A:3-152)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535669Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1535670Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1535773Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1535841Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species)
  7. 1535842Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries)
    Uniprot Q8RTL4 3-152
  8. 1535844Domain d2bmra1: 2bmr A:3-152 [128810]
    Other proteins in same PDB: d2bmra2, d2bmrb_
    automated match to d2bmoa1
    complexed with 3nt, edo, eoh, fe, fes, ni

Details for d2bmra1

PDB Entry: 2bmr (more details), 1.5 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with 3- nitrotoluene
PDB Compounds: (A:) oxygenase-alpha nbdo

SCOPe Domain Sequences for d2bmra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmra1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev
ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely
gdaikkkclglkevpriesfhgfiygcfda

SCOPe Domain Coordinates for d2bmra1:

Click to download the PDB-style file with coordinates for d2bmra1.
(The format of our PDB-style files is described here.)

Timeline for d2bmra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bmra2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bmrb_