Lineage for d2bmfb1 (2bmf B:483-618)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870436Protein Dengue virus helicase, C-terminal domain [418961] (1 species)
  7. 2870437Species Dengue virus type 2 [TaxId:11060] [419423] (2 PDB entries)
    Uniprot Q91H74
  8. 2870439Domain d2bmfb1: 2bmf B:483-618 [128793]
    Other proteins in same PDB: d2bmfa2, d2bmfa3, d2bmfb2, d2bmfb3
    automated match to d2bhra1

Details for d2bmfb1

PDB Entry: 2bmf (more details), 2.41 Å

PDB Description: dengue virus rna helicase at 2.4a
PDB Compounds: (B:) RNA helicase

SCOPe Domain Sequences for d2bmfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmfb1 c.37.1.14 (B:483-618) Dengue virus helicase, C-terminal domain {Dengue virus type 2 [TaxId: 11060]}
edcahwkeakmlldnintpegiipsmfeperekvdaidgeyrlrgearktfvdlmrrgdl
pvwlayrvaaeginyadrrwcfdgvknnqileenveveiwtkegerkklkprwldariys
dplalkefkefaagrk

SCOPe Domain Coordinates for d2bmfb1:

Click to download the PDB-style file with coordinates for d2bmfb1.
(The format of our PDB-style files is described here.)

Timeline for d2bmfb1: