Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (7 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein Dengue virus helicase, N-terminal domain [418960] (1 species) |
Species Dengue virus type 2 [TaxId:11060] [419422] (2 PDB entries) Uniprot Q91H74 |
Domain d2bmfa2: 2bmf A:171-482 [128792] Other proteins in same PDB: d2bmfa1, d2bmfa3, d2bmfb1, d2bmfb3 automated match to d2bhra2 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2bmf (more details), 2.41 Å
SCOPe Domain Sequences for d2bmfa2:
Sequence, based on SEQRES records: (download)
>d2bmfa2 c.37.1.14 (A:171-482) Dengue virus helicase, N-terminal domain {Dengue virus type 2 [TaxId: 11060]} siednpeieddifrkkrltimdlhpgagktkrylpaivreaikrglrtlilaptrvvaae meealrglpiryqtpairaehtgreivdlmchatftmrllspirvpnynliimdeahftd pasiaargyistrvemgeaagifmtatppgsrdpfpqsnapimdeereiperswnsghew vtdfkgktvwfvpsikagndiaaclrkngkkviqlsrktfdseyiktrtndwdfvvttdi semganfkaervidprrcmkpviltdgeervilagpmpvthssaaqrrgrvgrnpknend qyiymgeplend
>d2bmfa2 c.37.1.14 (A:171-482) Dengue virus helicase, N-terminal domain {Dengue virus type 2 [TaxId: 11060]} siednpeieddifrkkrltimdlhpgagktkrylpaivreaikrglrtlilaptrvvaae meealrglpiryqtgreivdlmchatftmrllspirvpnynliimdeahftdpasiaarg yistrvemgeaagifmtatppgsrdpfpqsnapimdeereiperswnsghewvtdfkgkt vwfvpsikagndiaaclrkngkkviqlsrktfdseyiktrtndwdfvvttdisemganfk aervidprrcmkpviltdgeervilagpmpvthssaaqrrgrvgrnpknendqyiymgep lend
Timeline for d2bmfa2: