SCOP 1.73: Domain d2bmea1: 2bme A:6-179

Lineage for d2bmea1 (2bme A:6-179)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab4a [142247] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142248] (4 PDB entries)

8. Domain d2bmea1: 2bme A:6-179 [128790]
   automatically matched to 2BMD A:6-186
   complexed with bme, gnp, mg, trs

Details for d2bmea1

PDB Entry: 2bme, 1.57 Å

PDB Description: high resolution structure of gppnhp-bound human rab4a

PDB Compounds: (A:) ras-related protein rab4a

SCOP Domain Sequences for d2bmea1:

Sequence; same for both SEQRES and ATOM records:

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}
tydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiwd
tagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkk
dldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesge

Timeline for d2bmea1:

• d2bmea1 is new in SCOP 1.73
  
• d2bmea1 appears in SCOP 1.75
  
• d2bmea1 appears in the current release, SCOPe 2.08, called d2bmea_