Lineage for d2bm1a5 (2bm1 A:600-688)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953534Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 2953535Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 2953539Domain d2bm1a5: 2bm1 A:600-688 [128757]
    Other proteins in same PDB: d2bm1a1, d2bm1a2, d2bm1a3
    automatically matched to d1dar_4
    complexed with gdp, mg; mutant

Details for d2bm1a5

PDB Entry: 2bm1 (more details), 2.6 Å

PDB Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant g16v
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bm1a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm1a5 d.58.11.1 (A:600-688) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdl
rsktqgrgsfvmffdhyqevpkqvqekli

SCOPe Domain Coordinates for d2bm1a5:

Click to download the PDB-style file with coordinates for d2bm1a5.
(The format of our PDB-style files is described here.)

Timeline for d2bm1a5: