Lineage for d2bm1a3 (2bm1 A:479-599)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891700Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1891730Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. 1891731Species Thermus thermophilus [TaxId:274] [54214] (9 PDB entries)
  8. 1891737Domain d2bm1a3: 2bm1 A:479-599 [128755]
    Other proteins in same PDB: d2bm1a1, d2bm1a2, d2bm1a4, d2bm1a5
    automatically matched to d1dar_3
    complexed with gdp, mg; mutant

Details for d2bm1a3

PDB Entry: 2bm1 (more details), 2.6 Å

PDB Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant g16v
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bm1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm1a3 d.14.1.1 (A:479-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]}
pqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkey
ipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgd
p

SCOPe Domain Coordinates for d2bm1a3:

Click to download the PDB-style file with coordinates for d2bm1a3.
(The format of our PDB-style files is described here.)

Timeline for d2bm1a3: