Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species) has internal nucleotide exchange factor built in as an insertion subdomain |
Species Thermus thermophilus [TaxId:274] [52634] (9 PDB entries) residues 160-252 comprise insertion subdomain |
Domain d2bm1a2: 2bm1 A:4-282 [128754] Other proteins in same PDB: d2bm1a1, d2bm1a3, d2bm1a4, d2bm1a5 automatically matched to d1dar_2 complexed with gdp, mg; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 2bm1 (more details), 2.6 Å
SCOPe Domain Sequences for d2bm1a2:
Sequence, based on SEQRES records: (download)
>d2bm1a2 c.37.1.8 (A:4-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} kveydlkrlrniviaahidagktttterilyytgrihkigevhegaatmdfmeqerergi titaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwr qaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrm kaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelv aairkgtidlkitpvflgsalknkgvqllldavvdylps
>d2bm1a2 c.37.1.8 (A:4-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} kveydlkrlrniviaahidagktttterilyytgriitaavttcfwkdhriniidtpghv dftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwl virtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldq areyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkg vqllldavvdylps
Timeline for d2bm1a2:
View in 3D Domains from same chain: (mouse over for more information) d2bm1a1, d2bm1a3, d2bm1a4, d2bm1a5 |