SCOPe 2.05: Domain d2bm0a4: 2bm0 A:404-478

Lineage for d2bm0a4 (2bm0 A:404-478)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor G (EF-G) [54982] (2 species)
   domain III is seen in 1FNM but disordered in the most of other PDB entries

7. Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)

8. Domain d2bm0a4: 2bm0 A:404-478 [128751]
   Other proteins in same PDB: d2bm0a1, d2bm0a2, d2bm0a3
   automatically matched to d1fnma4
   complexed with gdp, mg; mutant

Details for d2bm0a4

PDB Entry: 2bm0, 2.4 Å

PDB Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant t84a

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bm0a4:

Sequence; same for both SEQRES and ATOM records:

>d2bm0a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv
drlkrefkvdanvgk

Timeline for d2bm0a4:

• d2bm0a4 first appeared in SCOP 1.73
  
• d2bm0a4 appears in SCOPe 2.04
  
• d2bm0a4 appears in SCOPe 2.06
  
• d2bm0a4 appears in the current release, SCOPe 2.08