Lineage for d2bm0a4 (2bm0 A:404-478)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724976Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 724977Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 725026Protein Elongation factor G (EF-G) [54982] (2 species)
    domain III is seen in 1FNM but disordered in the most of other PDB entries
  7. 725027Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries)
  8. 725030Domain d2bm0a4: 2bm0 A:404-478 [128751]
    Other proteins in same PDB: d2bm0a1, d2bm0a2, d2bm0a3
    automatically matched to d1fnma4
    complexed with gdp, mg; mutant

Details for d2bm0a4

PDB Entry: 2bm0 (more details), 2.4 Å

PDB Description: ribosomal elongation factor g (ef-g) fusidic acid resistant mutant t84a
PDB Compounds: (A:) Elongation factor G

SCOP Domain Sequences for d2bm0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bm0a4 d.58.11.1 (A:404-478) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]}
vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv
drlkrefkvdanvgk

SCOP Domain Coordinates for d2bm0a4:

Click to download the PDB-style file with coordinates for d2bm0a4.
(The format of our PDB-style files is described here.)

Timeline for d2bm0a4: