SCOP 1.75: Domain d2bkza1: 2bkz A:-3-298

Lineage for d2bkza1 (2bkz A:-3-298)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (128 PDB entries)
   Uniprot P24941

8. Domain d2bkza1: 2bkz A:-3-298 [128719]
   Other proteins in same PDB: d2bkzb1, d2bkzb2, d2bkzd1, d2bkzd2
   automatically matched to d1vywa_
   complexed with sbc, so4

Details for d2bkza1

PDB Entry: 2bkz, 2.6 Å

PDB Description: structure of cdk2-cyclin a with pha-404611

PDB Compounds: (A:) Cell division protein kinase 2

SCOP Domain Sequences for d2bkza1:

Sequence; same for both SEQRES and ATOM records:

>d2bkza1 d.144.1.7 (A:-3-298) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
plvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
rl

Timeline for d2bkza1:

• d2bkza1 first appeared in SCOP 1.73
  
• d2bkza1 is called d2bkza_ in SCOPe 2.01
  
• d2bkza1 appears in the current release, SCOPe 2.08, called d2bkza2