Lineage for d2bkub1 (2bku B:1-861)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 646822Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
  6. 646864Protein Importin beta [48378] (3 species)
  7. 646865Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140814] (2 PDB entries)
  8. 646867Domain d2bkub1: 2bku B:1-861 [128712]
    complexed with gtp, mg

Details for d2bkub1

PDB Entry: 2bku (more details), 2.7 Å

PDB Description: kap95p:rangtp complex
PDB Compounds: (B:) importin beta-1 subunit

SCOP Domain Sequences for d2bkub1:

Sequence, based on SEQRES records: (download)

>d2bkub1 a.118.1.1 (B:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadpqsqalvsssnni
liaivqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaediev
qaaafgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidi
ayelaqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaq
ncgnhilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlm
ndqslqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinl
veqlaeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsa
sistfvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmg
lffrllekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitav
gfiadisnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipy
lndimalcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtif
qfiaqvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlf
sqatkdtarwareqqkrqlsl

Sequence, based on observed residues (ATOM records): (download)

>d2bkub1 a.118.1.1 (B:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mstaefaqllensilspdqnirltsetqlkklsndnflqfaglssqvlidentklegril
aaltlknelvskdsvktqqfaqrwitqvspeaknqiktnaltalvsieprianaaaqlia
aiadielphgawpelmkimvdntgaeqpenvkrasllalgymcesadalvsssnniliai
vqgaqstetskavrlaalnaladslifiknnmeregernylmqvvceatqaedievqaaa
fgclckimskyytfmkpymeqalyaltiatmkspndkvasmtvefwsticeeeidiayel
aqfpqsplqsynfalssikdvvpnllnlltrqnedpedddwnvsmsagaclqlfaqncgn
hilepvlefveqnitadnwrnreaavmafgsimdgpdkvqrtyyvhqalpsilnlmndqs
lqvkettawcigriadsvaesidpqqhlpgvvqacliglqdhpkvatncswtiinlveql
aeatpspiynfypalvdgligaanridnefnarasafsalttmveyatdtvaetsasist
fvmdklgqtmsvdenqltledaqslqelqsniltvlaavirkspssvepvadmlmglffr
llekkdsafieddvfyaisalaaslgkgfekyletfspyllkalnqvdspvsitavgfia
disnsleedfrrysdammnvlaqmisnpnarrelkpavlsvfgdiasnigadfipylndi
malcvaaqntkpengtlealdyqikvleavldayvgivaglhdkpealfpyvgtifqfia
qvaedpqlysedatsraavgligdiaamfpdgsikqfygqdwvidyikrtrsgqlfsqat
kdtarwareqqkrqlsl

SCOP Domain Coordinates for d2bkub1:

Click to download the PDB-style file with coordinates for d2bkub1.
(The format of our PDB-style files is described here.)

Timeline for d2bkub1: