Lineage for d2bkca1 (2bkc A:7-156)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264537Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1264715Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries)
  8. 1264717Domain d2bkca1: 2bkc A:7-156 [128675]
    Other proteins in same PDB: d2bkcb_, d2bkcc_, d2bkcd_, d2bkce_, d2bkcf_, d2bkcg_, d2bkch_, d2bkci_, d2bkcj_, d2bkck_, d2bkcl_, d2bkcm_, d2bkcn_, d2bkco_, d2bkcp_, d2bkcq_, d2bkcr_, d2bkcs_, d2bkct_, d2bkcu_, d2bkcv_, d2bkcx_, d2bkcy_
    mutant

Details for d2bkca1

PDB Entry: 2bkc (more details), 2.3 Å

PDB Description: the x-ray structure of the h43g listeria innocua dps mutant
PDB Compounds: (A:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkca1 a.25.1.1 (A:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bkca1:

Click to download the PDB-style file with coordinates for d2bkca1.
(The format of our PDB-style files is described here.)

Timeline for d2bkca1: