Lineage for d2bkca1 (2bkc A:7-156)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766410Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries)
  8. 766417Domain d2bkca1: 2bkc A:7-156 [128675]
    mutant

Details for d2bkca1

PDB Entry: 2bkc (more details), 2.3 Å

PDB Description: the x-ray structure of the h43g listeria innocua dps mutant
PDB Compounds: (A:) non-heme iron-containing ferritin

SCOP Domain Sequences for d2bkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkca1 a.25.1.1 (A:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOP Domain Coordinates for d2bkca1:

Click to download the PDB-style file with coordinates for d2bkca1.
(The format of our PDB-style files is described here.)

Timeline for d2bkca1: