SCOPe 2.08: Domain d2bkbc2: 2bkb C:83-192

Lineage for d2bkbc2 (2bkb C:83-192)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein automated matches [226880] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255057] (1 PDB entry)

8. Domain d2bkbc2: 2bkb C:83-192 [128672]
   Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1
   automated match to d2nyba2
   complexed with fe2

Details for d2bkbc2

PDB Entry: 2bkb, 1.7 Å

PDB Description: q69e-fesod

PDB Compounds: (C:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkbc2:

Sequence; same for both SEQRES and ATOM records:

>d2bkbc2 d.44.1.1 (C:83-192) automated matches {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

Timeline for d2bkbc2:

• d2bkbc2 first appeared in SCOP 1.73
  
• d2bkbc2 appears in SCOPe 2.07