SCOP 1.73: Domain d2bkbb2: 2bkb B:283-392

Lineage for d2bkbb2 (2bkb B:283-392)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)

7. Species Escherichia coli [TaxId:562] [54727] (6 PDB entries)

8. Domain d2bkbb2: 2bkb B:283-392 [128670]
   Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1
   automatically matched to d1isaa2
   complexed with fe2; mutant

Details for d2bkbb2

PDB Entry: 2bkb, 1.7 Å

PDB Description: q69e-fesod

PDB Compounds: (B:) superoxide dismutase [fe]

SCOP Domain Sequences for d2bkbb2:

Sequence; same for both SEQRES and ATOM records:

>d2bkbb2 d.44.1.1 (B:283-392) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

Timeline for d2bkbb2:

• d2bkbb2 is new in SCOP 1.73
  
• d2bkbb2 appears in SCOP 1.75
  
• d2bkbb2 appears in the current release, SCOPe 2.08