Lineage for d2bk6f_ (2bk6 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1728784Species Listeria innocua [TaxId:1642] [186977] (3 PDB entries)
  8. 1728789Domain d2bk6f_: 2bk6 F: [128665]
    Other proteins in same PDB: d2bk6a1
    automated match to d1qgha_
    mutant

Details for d2bk6f_

PDB Entry: 2bk6 (more details), 2.19 Å

PDB Description: the x-ray crystal structure of the listeria innocua h31g dps mutant.
PDB Compounds: (F:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bk6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk6f_ a.25.1.1 (F:) automated matches {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bk6f_:

Click to download the PDB-style file with coordinates for d2bk6f_.
(The format of our PDB-style files is described here.)

Timeline for d2bk6f_: