Lineage for d2bk5b2 (2bk5 B:290-401)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 855121Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 855155Protein Monoamine oxidase B [69673] (2 species)
  7. 855195Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries)
  8. 855205Domain d2bk5b2: 2bk5 B:290-401 [128659]
    Other proteins in same PDB: d2bk5a1, d2bk5b1
    automatically matched to d1o5wa2
    complexed with fad, isn; mutant

Details for d2bk5b2

PDB Entry: 2bk5 (more details), 1.83 Å

PDB Description: human monoamine oxidase b: i199f mutant in complex with isatin
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOP Domain Sequences for d2bk5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk5b2 d.16.1.5 (B:290-401) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d2bk5b2:

Click to download the PDB-style file with coordinates for d2bk5b2.
(The format of our PDB-style files is described here.)

Timeline for d2bk5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bk5b1