Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins) |
Protein Monoamine oxidase B [69673] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [102801] (14 PDB entries) |
Domain d2bk5a2: 2bk5 A:290-401 [128657] Other proteins in same PDB: d2bk5a1, d2bk5b1 automatically matched to d1o5wa2 complexed with fad, isn; mutant |
PDB Entry: 2bk5 (more details), 1.83 Å
SCOP Domain Sequences for d2bk5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bk5a2 d.16.1.5 (A:290-401) Monoamine oxidase B {Rat (Rattus norvegicus) [TaxId: 10116]} plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty
Timeline for d2bk5a2: