Lineage for d2bjyl_ (2bjy L:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990696Species Listeria innocua [TaxId:1642] [186977] (3 PDB entries)
  8. 1990735Domain d2bjyl_: 2bjy L: [128645]
    Other proteins in same PDB: d2bjya1
    automated match to d1qgha_
    mutant

Details for d2bjyl_

PDB Entry: 2bjy (more details), 2.6 Å

PDB Description: the x-ray crystal structure of listeria innocua dps h31g-h43g mutant.
PDB Compounds: (L:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bjyl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjyl_ a.25.1.1 (L:) automated matches {Listeria innocua [TaxId: 1642]}
nsvdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerl
laiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkeg
ddvtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bjyl_:

Click to download the PDB-style file with coordinates for d2bjyl_.
(The format of our PDB-style files is described here.)

Timeline for d2bjyl_: