Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries) |
Domain d2bjyj1: 2bjy J:7-156 [128643] automatically matched to 2BJY A:7-156 mutant |
PDB Entry: 2bjy (more details), 2.6 Å
SCOP Domain Sequences for d2bjyj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjyj1 a.25.1.1 (J:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]} vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd vtndmliafkasidkhiwmfkaflgkaple
Timeline for d2bjyj1: