Lineage for d2bjya1 (2bjy A:7-156)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728042Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1728220Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries)
  8. 1728235Domain d2bjya1: 2bjy A:7-156 [128634]
    Other proteins in same PDB: d2bjyb_, d2bjyc_, d2bjyd_, d2bjye_, d2bjyf_, d2bjyg_, d2bjyh_, d2bjyi_, d2bjyj_, d2bjyk_, d2bjyl_
    mutant

Details for d2bjya1

PDB Entry: 2bjy (more details), 2.6 Å

PDB Description: the x-ray crystal structure of listeria innocua dps h31g-h43g mutant.
PDB Compounds: (A:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bjya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjya1 a.25.1.1 (A:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqigwymrghnfftlgekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bjya1:

Click to download the PDB-style file with coordinates for d2bjya1.
(The format of our PDB-style files is described here.)

Timeline for d2bjya1: