SCOPe 2.08: Domain d2bisc2: 2bis C:1-437

Lineage for d2bisc2 (2bis C:1-437)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.8: Glycosyl transferases group 1 [110734] (4 proteins)
   Pfam PF00534

6. Protein automated matches [190508] (1 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [187462] (2 PDB entries)

8. Domain d2bisc2: 2bis C:1-437 [128589]
   Other proteins in same PDB: d2bisa1, d2bisb3, d2bisc3
   automated match to d2bisa1
   complexed with dio, glc, gol, udp

Details for d2bisc2

PDB Entry: 2bis, 2.8 Å

PDB Description: structure of glycogen synthase from pyrococcus abyssi

PDB Compounds: (C:) glga glycogen synthase

SCOPe Domain Sequences for d2bisc2:

Sequence; same for both SEQRES and ATOM records:

>d2bisc2 c.87.1.8 (C:1-437) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mkvlllgfeflpvkvgglaealtaisealaslghevlvftpshgrfqgeeigkirvfgee
vqvkvsyeergnlriyriggglldsedvygpgwdglirkavtfgrasvlllndllreepl
pdvvhfhdwhtvfagalikkyfkipavftihrlnksklpafyfheaglselapypdidpe
htggyiadivttvsrgylidewgffrnfegkityvfngidcsfwnesyltgsrderkksl
lskfgmdegvtfmfigrfdrgqkgvdvllkaieilsskkefqemrfiiigkgdpelegwa
rsleekhgnvkvitemlsrefvrelygsvdfviipsyfepfglvaleamclgaipiasav
gglrdiitnetgilvkagdpgelanailkalelsrsdlskfrenckkramsfsweksaer
yvkaytgsidrafdfil

Timeline for d2bisc2:

• d2bisc2 first appeared in SCOP 1.73, called d2bisc1
  
• d2bisc2 was called d2bisc_ in SCOPe 2.07