Lineage for d2bhza2 (2bhz A:531-602)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328152Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)
  7. 1328153Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries)
    Uniprot Q9RX51 529-600
  8. 1328155Domain d2bhza2: 2bhz A:531-602 [128563]
    Other proteins in same PDB: d2bhza1, d2bhza3
    automated match to d2bhua2
    complexed with bme, mal, mg, trs

Details for d2bhza2

PDB Entry: 2bhz (more details), 1.2 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose
PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2bhza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhza2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]}
qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred
ltlgageavlvg

SCOPe Domain Coordinates for d2bhza2:

Click to download the PDB-style file with coordinates for d2bhza2.
(The format of our PDB-style files is described here.)

Timeline for d2bhza2: