SCOPe 2.08: Domain d2bhza1: 2bhz A:14-110

Lineage for d2bhza1 (2bhz A:14-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
   domain architecture similar to isoamylase

7. Species Deinococcus radiodurans [TaxId:1299] [141019] (9 PDB entries)
   Uniprot Q9RX51 14-110

8. Domain d2bhza1: 2bhz A:14-110 [128562]
   Other proteins in same PDB: d2bhza2, d2bhza3
   automated match to d2bhua1
   complexed with bme, mg, trs

Details for d2bhza1

PDB Entry: 2bhz, 1.2 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose

PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d2bhza1:

Sequence; same for both SEQRES and ATOM records:

>d2bhza1 b.1.18.2 (A:14-110) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Deinococcus radiodurans [TaxId: 1299]}
sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
gpgarylfvldgvptpdpyarflpdgvhgeaevvdfg

Timeline for d2bhza1:

• d2bhza1 first appeared in SCOP 1.73
  
• d2bhza1 appears in SCOPe 2.07