Lineage for d2bhua2 (2bhu A:531-602)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808387Protein Glycosyltrehalose trehalohydrolase [51034] (2 species)
  7. 808391Species Deinococcus radiodurans [TaxId:1299] [141553] (9 PDB entries)
    Uniprot Q9RX51 529-600
  8. 808392Domain d2bhua2: 2bhu A:531-602 [128555]
    Other proteins in same PDB: d2bhua1, d2bhua3
    complexed with mg, pge, trs; mutant

Details for d2bhua2

PDB Entry: 2bhu (more details), 1.1 Å

PDB Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase
PDB Compounds: (A:) maltooligosyltrehalose trehalohydrolase

SCOP Domain Sequences for d2bhua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhua2 b.71.1.1 (A:531-602) Glycosyltrehalose trehalohydrolase {Deinococcus radiodurans [TaxId: 1299]}
qrenlttghdgdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegred
ltlgageavlvg

SCOP Domain Coordinates for d2bhua2:

Click to download the PDB-style file with coordinates for d2bhua2.
(The format of our PDB-style files is described here.)

Timeline for d2bhua2: