SCOP 1.73: Domain d2bhsd1: 2bhs D:2-292

Lineage for d2bhsd1 (2bhs D:2-292)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)

7. Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries)

8. Domain d2bhsd1: 2bhs D:2-292 [128549]
   automatically matched to 2BHS A:2-293
   complexed with plp

Details for d2bhsd1

PDB Entry: 2bhs, 2.67 Å

PDB Description: crystal structure of cysteine synthase b

PDB Compounds: (D:) Cysteine synthase B

SCOP Domain Sequences for d2bhsd1:

Sequence; same for both SEQRES and ATOM records:

>d2bhsd1 c.79.1.1 (D:2-292) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]}
stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgeikpg
dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg
ardlalemanrgegklldqfnnpdnpyahytttgpeiwqqtggrithfvssmgttgtitg
vsrfmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm
relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvf

Timeline for d2bhsd1:

• d2bhsd1 is new in SCOP 1.73
  
• d2bhsd1 appears in SCOP 1.75
  
• d2bhsd1 appears in the current release, SCOPe 2.08, called d2bhsd_