Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins) |
Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species) |
Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries) |
Domain d2bhsd1: 2bhs D:2-292 [128549] automatically matched to 2BHS A:2-293 complexed with plp |
PDB Entry: 2bhs (more details), 2.67 Å
SCOP Domain Sequences for d2bhsd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhsd1 c.79.1.1 (D:2-292) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgeikpg dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg ardlalemanrgegklldqfnnpdnpyahytttgpeiwqqtggrithfvssmgttgtitg vsrfmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvf
Timeline for d2bhsd1: