Lineage for d2bhnd1 (2bhn D:160-229)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715718Family a.60.2.5: Hef domain-like [140629] (4 proteins)
    helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
  6. 2715728Protein DNA repair endonuclease XPF [140634] (2 species)
  7. 2715729Species Aeropyrum pernix [TaxId:56636] [140635] (2 PDB entries)
    Uniprot Q9YC15 160-229
  8. 2715735Domain d2bhnd1: 2bhn D:160-229 [128540]
    Other proteins in same PDB: d2bhna2, d2bhnb2, d2bhnc2, d2bhnd2
    automatically matched to 2BGW A:160-229

Details for d2bhnd1

PDB Entry: 2bhn (more details), 3.2 Å

PDB Description: xpf from aeropyrum pernix
PDB Compounds: (D:) xpf endonuclease

SCOPe Domain Sequences for d2bhnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhnd1 a.60.2.5 (D:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]}
kprlsdvrewqlyilqsfpgigrrtaerilerfgslerfftaskaeiskvegigekraee
ikkilmtpyk

SCOPe Domain Coordinates for d2bhnd1:

Click to download the PDB-style file with coordinates for d2bhnd1.
(The format of our PDB-style files is described here.)

Timeline for d2bhnd1: