Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (33 families) |
Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) |
Protein XPF endonuclease [142447] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries) Uniprot Q9YC15 16-148 |
Domain d2bhnb2: 2bhn B:19-148 [128537] Other proteins in same PDB: d2bhna1, d2bhnb1, d2bhnc1, d2bhnd1 automatically matched to 2BGW A:16-148 |
PDB Entry: 2bhn (more details), 3.2 Å
SCOP Domain Sequences for d2bhnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhnb2 c.52.1.20 (B:19-148) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]} prvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrl feqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtal vieslarlst
Timeline for d2bhnb2: