Lineage for d2bgkb_ (2bgk B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350687Species Mayapple (Podophyllum peltatum) [TaxId:35933] [186973] (3 PDB entries)
  8. 1350688Domain d2bgkb_: 2bgk B: [128481]
    Other proteins in same PDB: d2bgka1
    automated match to d1nffa_

Details for d2bgkb_

PDB Entry: 2bgk (more details), 1.6 Å

PDB Description: x-ray structure of apo-secoisolariciresinol dehydrogenase
PDB Compounds: (B:) rhizome secoisolariciresinol dehydrogenase

SCOPe Domain Sequences for d2bgkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgkb_ c.2.1.0 (B:) automated matches {Mayapple (Podophyllum peltatum) [TaxId: 35933]}
tnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnnigspdvisfvh
cdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkrvmdinvygaf
lvakhaarvmipakkgsivftasissftagegvshvytatkhavlglttslctelgeygi
rvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadavaylagdesky
vsglnlvidggytrtnpafptalkhgla

SCOPe Domain Coordinates for d2bgkb_:

Click to download the PDB-style file with coordinates for d2bgkb_.
(The format of our PDB-style files is described here.)

Timeline for d2bgkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bgka1