Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Penicillin-binding protein 1b, transpeptidase domain [144036] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [144037] (3 PDB entries) Uniprot O70038 337-789! Uniprot O70038 337-791 |
Domain d2bg1a1: 2bg1 A:337-789 [128457] complexed with cl, so4 |
PDB Entry: 2bg1 (more details), 1.9 Å
SCOPe Domain Sequences for d2bg1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bg1a1 e.3.1.1 (A:337-789) Penicillin-binding protein 1b, transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} dylyfttlaeaqermydylaqrdnvsakelkneatqkfyrdlaakeienggykitttidq kihsamqsavadygyllddgtgrvevgnvlmdnqtgailgfvggrnyqenqnnhafdtkr spasttkpllaygiaidqglmgsetilsnyptnfangnpimyanskgtgmmtlgealnys wnipaywtyrmlrengvdvkgymekmgyeipeygieslpmgggievtvaqhtngyqtlan ngvyhqkhviskieaadgrvvyeyqdkpvqvyskatatimqgllrevlssrvtttfksnl tslnptlanadwigktgttnqdenmwlmlstprltlggwighddnhslsqqagysnnsny mahlvnaiqqaspsiwgnerfaldpsvvksevlkstgqkpgkvsvegkevevtgstvtsy wanksgapatsyrfaiggsdadyqnawssivgs
Timeline for d2bg1a1: