Lineage for d2bg1a1 (2bg1 A:337-789)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013508Protein Penicillin-binding protein 1b, transpeptidase domain [144036] (1 species)
  7. 3013509Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [144037] (3 PDB entries)
    Uniprot O70038 337-789! Uniprot O70038 337-791
  8. 3013512Domain d2bg1a1: 2bg1 A:337-789 [128457]
    complexed with cl, so4

Details for d2bg1a1

PDB Entry: 2bg1 (more details), 1.9 Å

PDB Description: active site restructuring regulates ligand recognition in classa penicillin-binding proteins (pbps)
PDB Compounds: (A:) penicillin-binding protein 1b

SCOPe Domain Sequences for d2bg1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bg1a1 e.3.1.1 (A:337-789) Penicillin-binding protein 1b, transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
dylyfttlaeaqermydylaqrdnvsakelkneatqkfyrdlaakeienggykitttidq
kihsamqsavadygyllddgtgrvevgnvlmdnqtgailgfvggrnyqenqnnhafdtkr
spasttkpllaygiaidqglmgsetilsnyptnfangnpimyanskgtgmmtlgealnys
wnipaywtyrmlrengvdvkgymekmgyeipeygieslpmgggievtvaqhtngyqtlan
ngvyhqkhviskieaadgrvvyeyqdkpvqvyskatatimqgllrevlssrvtttfksnl
tslnptlanadwigktgttnqdenmwlmlstprltlggwighddnhslsqqagysnnsny
mahlvnaiqqaspsiwgnerfaldpsvvksevlkstgqkpgkvsvegkevevtgstvtsy
wanksgapatsyrfaiggsdadyqnawssivgs

SCOPe Domain Coordinates for d2bg1a1:

Click to download the PDB-style file with coordinates for d2bg1a1.
(The format of our PDB-style files is described here.)

Timeline for d2bg1a1: