Lineage for d2bexc1 (2bex C:0-134)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715752Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 715753Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 715754Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 715804Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 715805Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 715816Domain d2bexc1: 2bex C:0-134 [128400]
    Other proteins in same PDB: d2bexa1, d2bexb1
    automatically matched to d1gqva_
    complexed with gol, mak

Details for d2bexc1

PDB Entry: 2bex (more details), 1.99 Å

PDB Description: crystal structure of placental ribonuclease inhibitor in complex with human eosinophil derived neurotoxin at 2a resolution
PDB Compounds: (C:) nonsecretory ribonuclease

SCOP Domain Sequences for d2bexc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bexc1 d.5.1.1 (C:0-134) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOP Domain Coordinates for d2bexc1:

Click to download the PDB-style file with coordinates for d2bexc1.
(The format of our PDB-style files is described here.)

Timeline for d2bexc1: