Lineage for d2bera2 (2ber A:506-647)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1778016Species Micromonospora viridifaciens [TaxId:1881] [254943] (3 PDB entries)
  8. 1778017Domain d2bera2: 2ber A:506-647 [128387]
    Other proteins in same PDB: d2bera1, d2bera3
    automated match to d1w8oa2
    complexed with na, slb; mutant

Details for d2bera2

PDB Entry: 2ber (more details), 1.8 Å

PDB Description: y370g active site mutant of the sialidase from micromonospora viridifaciens in complex with beta-neu5ac (sialic acid).
PDB Compounds: (A:) bacterial sialidase

SCOPe Domain Sequences for d2bera2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bera2 b.18.1.0 (A:506-647) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
qarmsiadvdseetaredgrasnvidgnpstfwhtewsradapgyphrisldlggthtis
glqytrrqnsaneqvadyeiytslngttwdgpvasgrfttslapqravfpardaryirlv
alseqtghkyaavaelevegqr

SCOPe Domain Coordinates for d2bera2:

Click to download the PDB-style file with coordinates for d2bera2.
(The format of our PDB-style files is described here.)

Timeline for d2bera2: