Lineage for d2bera1 (2ber A:405-505)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658895Protein Sialidase, "linker" domain [49237] (1 species)
    follows the catalytic six-bladed beta-propeller domain
  7. 658896Species Micromonospora viridifaciens [TaxId:1881] [49238] (6 PDB entries)
  8. 658898Domain d2bera1: 2ber A:405-505 [128386]
    Other proteins in same PDB: d2bera2, d2bera3
    automatically matched to d1eut_1
    complexed with na, slb; mutant

Details for d2bera1

PDB Entry: 2ber (more details), 1.8 Å

PDB Description: y370g active site mutant of the sialidase from micromonospora viridifaciens in complex with beta-neu5ac (sialic acid).
PDB Compounds: (A:) bacterial sialidase

SCOP Domain Sequences for d2bera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bera1 b.1.18.2 (A:405-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]}
capftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrqak
gqvtitvpagttpgryrvgatlrtsagnasttftvtvglld

SCOP Domain Coordinates for d2bera1:

Click to download the PDB-style file with coordinates for d2bera1.
(The format of our PDB-style files is described here.)

Timeline for d2bera1: