Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
Species Sulfolobus acidocaldarius [TaxId:2285] [110719] (2 PDB entries) Uniprot Q55338 |
Domain d2be9a2: 2be9 A:147-299 [128372] Other proteins in same PDB: d2be9b1, d2be9b2 automated match to d1pg5a2 complexed with ctp, so4, zn |
PDB Entry: 2be9 (more details), 2.6 Å
SCOPe Domain Sequences for d2be9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2be9a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Sulfolobus acidocaldarius [TaxId: 2285]} idglvfallgdlkyartvnsllriltrfrpklvylispqllrarkeildelnypvkeven pfevinevdvlyvtriqkerfvdemeyekikgsyivsldlankmkkdsiilhplprvnei drkvdkttkakyfeqasygvpvrmsiltkiyge
Timeline for d2be9a2: