SCOPe 2.07: Domain d2be9a2: 2be9 A:147-299

Lineage for d2be9a2 (2be9 A:147-299)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)

7. Species Sulfolobus acidocaldarius [TaxId:2285] [110719] (2 PDB entries)
   Uniprot Q55338

8. Domain d2be9a2: 2be9 A:147-299 [128372]
   Other proteins in same PDB: d2be9b1, d2be9b2
   automated match to d1pg5a2
   complexed with ctp, so4, zn

Details for d2be9a2

PDB Entry: 2be9, 2.6 Å

PDB Description: Crystal structure of the CTP-liganded (T-State) aspartate transcarbamoylase from the extremely thermophilic archaeon Sulfolobus acidocaldarius

PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d2be9a2:

Sequence; same for both SEQRES and ATOM records:

>d2be9a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Sulfolobus acidocaldarius [TaxId: 2285]}
idglvfallgdlkyartvnsllriltrfrpklvylispqllrarkeildelnypvkeven
pfevinevdvlyvtriqkerfvdemeyekikgsyivsldlankmkkdsiilhplprvnei
drkvdkttkakyfeqasygvpvrmsiltkiyge

Timeline for d2be9a2:

• d2be9a2 first appeared in SCOP 1.73
  
• d2be9a2 appears in SCOPe 2.06
  
• d2be9a2 appears in the current release, SCOPe 2.08