Lineage for d2be5f1 (2be5 F:258-318)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763476Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 763477Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 763489Protein Sigma70 [88661] (1 species)
  7. 763490Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries)
    Uniprot Q9WX78
  8. 763499Domain d2be5f1: 2be5 F:258-318 [128358]
    Other proteins in same PDB: d2be5a1, d2be5a2, d2be5b1, d2be5b2, d2be5c1, d2be5d1, d2be5e1, d2be5f2, d2be5f3, d2be5k1, d2be5k2, d2be5l1, d2be5l2, d2be5m1, d2be5n1, d2be5o1, d2be5p2, d2be5p3
    automatically matched to d1iw7f1
    complexed with mg, tgt, zn

Details for d2be5f1

PDB Entry: 2be5 (more details), 2.4 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme in complex with inhibitor tagetitoxin
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOP Domain Sequences for d2be5f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2be5f1 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOP Domain Coordinates for d2be5f1:

Click to download the PDB-style file with coordinates for d2be5f1.
(The format of our PDB-style files is described here.)

Timeline for d2be5f1: