Lineage for d2bd8a_ (2bd8 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1318797Protein Elastase [50536] (4 species)
  7. 1318807Species Pig (Sus scrofa) [TaxId:9823] [50538] (116 PDB entries)
  8. 1318852Domain d2bd8a_: 2bd8 A: [128330]
    automated match to d1b0ea_
    complexed with arg, ca, phe, so4

Details for d2bd8a_

PDB Entry: 2bd8 (more details), 1.7 Å

PDB Description: porcine pancreatic elastase complexed with beta-casomorphin-7 and arg- phe at ph 5.0 (50 min soak) and immersed in ph 9 buffer for 30 seconds
PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d2bd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bd8a_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d2bd8a_:

Click to download the PDB-style file with coordinates for d2bd8a_.
(The format of our PDB-style files is described here.)

Timeline for d2bd8a_: