SCOPe 2.06: Domain d2bcwa1: 2bcw A:8-70

Lineage for d2bcwa1 (2bcw A:8-70)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [54750] (2 PDB entries)

8. Domain d2bcwa1: 2bcw A:8-70 [128319]
   Other proteins in same PDB: d2bcwb1
   automatically matched to d1mmsa2

Details for d2bcwa1

PDB Entry: 2bcw, 11.2 Å

PDB Description: coordinates of the n-terminal domain of ribosomal protein l11,c- terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex

PDB Compounds: (A:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2bcwa1:

Sequence; same for both SEQRES and ATOM records:

>d2bcwa1 d.47.1.1 (A:8-70) Ribosomal protein L11, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

Timeline for d2bcwa1:

• d2bcwa1 first appeared in SCOP 1.73
  
• d2bcwa1 appears in SCOPe 2.05
  
• d2bcwa1 appears in SCOPe 2.07
  
• d2bcwa1 appears in the current release, SCOPe 2.08